Protein Description: cleavage and polyadenylation specific factor 4, 30kDa
Gene Name: CPSF4
Alternative Gene Name: CPSF30, NAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029625: 98%, ENSRNOG00000000985: 53%
Entrez Gene ID: 10898
Uniprot ID: O95639
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CPSF4
Alternative Gene Name: CPSF30, NAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029625: 98%, ENSRNOG00000000985: 53%
Entrez Gene ID: 10898
Uniprot ID: O95639
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQSNNPPLQRSSSLIQLTSQNSSPNQQ |
Documents & Links for Anti CPSF4 pAb (ATL-HPA066470) | |
Datasheet | Anti CPSF4 pAb (ATL-HPA066470) Datasheet (External Link) |
Vendor Page | Anti CPSF4 pAb (ATL-HPA066470) at Atlas |
Documents & Links for Anti CPSF4 pAb (ATL-HPA066470) | |
Datasheet | Anti CPSF4 pAb (ATL-HPA066470) Datasheet (External Link) |
Vendor Page | Anti CPSF4 pAb (ATL-HPA066470) |