Anti CPSF4 pAb (ATL-HPA066470)

Catalog No:
ATL-HPA066470-25
$401.00
Protein Description: cleavage and polyadenylation specific factor 4, 30kDa
Gene Name: CPSF4
Alternative Gene Name: CPSF30, NAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029625: 98%, ENSRNOG00000000985: 53%
Entrez Gene ID: 10898
Uniprot ID: O95639
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence PSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQSNNPPLQRSSSLIQLTSQNSSPNQQ

Documents & Links for Anti CPSF4 pAb (ATL-HPA066470)
Datasheet Anti CPSF4 pAb (ATL-HPA066470) Datasheet (External Link)
Vendor Page Anti CPSF4 pAb (ATL-HPA066470) at Atlas

Documents & Links for Anti CPSF4 pAb (ATL-HPA066470)
Datasheet Anti CPSF4 pAb (ATL-HPA066470) Datasheet (External Link)
Vendor Page Anti CPSF4 pAb (ATL-HPA066470)