Protein Description: cleavage and polyadenylation specific factor 1, 160kDa
Gene Name: CPSF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034022: 99%, ENSRNOG00000030705: 99%
Entrez Gene ID: 29894
Uniprot ID: Q10570
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CPSF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034022: 99%, ENSRNOG00000030705: 99%
Entrez Gene ID: 29894
Uniprot ID: Q10570
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AISLNITQKVHPVIWSLTSLPFDCTQALAVPKPIGGVVVFAVNSLLYLNQSVPPYGVALNSLTTGTTAFPLRT |
| Documents & Links for Anti CPSF1 pAb (ATL-HPA068906) | |
| Datasheet | Anti CPSF1 pAb (ATL-HPA068906) Datasheet (External Link) |
| Vendor Page | Anti CPSF1 pAb (ATL-HPA068906) at Atlas |
| Documents & Links for Anti CPSF1 pAb (ATL-HPA068906) | |
| Datasheet | Anti CPSF1 pAb (ATL-HPA068906) Datasheet (External Link) |
| Vendor Page | Anti CPSF1 pAb (ATL-HPA068906) |