Description
Product Description
Protein Description: cleavage and polyadenylation specific factor 1, 160kDa
Gene Name: CPSF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034022: 99%, ENSRNOG00000030705: 99%
Entrez Gene ID: 29894
Uniprot ID: Q10570
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CPSF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034022: 99%, ENSRNOG00000030705: 99%
Entrez Gene ID: 29894
Uniprot ID: Q10570
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AISLNITQKVHPVIWSLTSLPFDCTQALAVPKPIGGVVVFAVNSLLYLNQSVPPYGVALNSLTTGTTAFPLRT |
Gene Sequence | AISLNITQKVHPVIWSLTSLPFDCTQALAVPKPIGGVVVFAVNSLLYLNQSVPPYGVALNSLTTGTTAFPLRT |
Gene ID - Mouse | ENSMUSG00000034022 |
Gene ID - Rat | ENSRNOG00000030705 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CPSF1 pAb (ATL-HPA068906) | |
Datasheet | Anti CPSF1 pAb (ATL-HPA068906) Datasheet (External Link) |
Vendor Page | Anti CPSF1 pAb (ATL-HPA068906) at Atlas Antibodies |
Documents & Links for Anti CPSF1 pAb (ATL-HPA068906) | |
Datasheet | Anti CPSF1 pAb (ATL-HPA068906) Datasheet (External Link) |
Vendor Page | Anti CPSF1 pAb (ATL-HPA068906) |