Anti CPSF1 pAb (ATL-HPA068906)

Atlas Antibodies

Catalog No: ATL-HPA068906-25

• 

Product Description

Protein Description: cleavage and polyadenylation specific factor 1, 160kDa
Gene Name: CPSF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034022: 99%, ENSRNOG00000030705: 99%
Entrez Gene ID: 29894
Uniprot ID: Q10570
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AISLNITQKVHPVIWSLTSLPFDCTQALAVPKPIGGVVVFAVNSLLYLNQSVPPYGVALNSLTTGTTAFPLRT
• Gene Sequence: AISLNITQKVHPVIWSLTSLPFDCTQALAVPKPIGGVVVFAVNSLLYLNQSVPPYGVALNSLTTGTTAFPLRT
• Gene ID - Mouse: ENSMUSG00000034022
• Gene ID - Rat: ENSRNOG00000030705
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.