Protein Description: copine 4
Gene Name: CPNE4
Alternative Gene Name: COPN4, CPN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032564: 97%, ENSRNOG00000026577: 97%
Entrez Gene ID: 131034
Uniprot ID: Q96A23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CPNE4
Alternative Gene Name: COPN4, CPN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032564: 97%, ENSRNOG00000026577: 97%
Entrez Gene ID: 131034
Uniprot ID: Q96A23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AEVPNQVVDYYNGKGIKPKCSSEMYESSRTLAP |
| Documents & Links for Anti CPNE4 pAb (ATL-HPA078300 w/enhanced validation) | |
| Datasheet | Anti CPNE4 pAb (ATL-HPA078300 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CPNE4 pAb (ATL-HPA078300 w/enhanced validation) at Atlas |
| Documents & Links for Anti CPNE4 pAb (ATL-HPA078300 w/enhanced validation) | |
| Datasheet | Anti CPNE4 pAb (ATL-HPA078300 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CPNE4 pAb (ATL-HPA078300 w/enhanced validation) |