Anti CPNE1 pAb (ATL-HPA072634 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA072634-100

• 
• 

Product Description

Protein Description: copine I
Gene Name: CPNE1
Alternative Gene Name: CPN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074643: 90%, ENSRNOG00000046990: 93%
Entrez Gene ID: 8904
Uniprot ID: Q99829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLIGTFHTSLAQLQAVPAEFECIHPEKQQK
• Gene Sequence: DLIGTFHTSLAQLQAVPAEFECIHPEKQQK
• Gene ID - Mouse: ENSMUSG00000074643
• Gene ID - Rat: ENSRNOG00000046990
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.