Protein Description: copine I
Gene Name: CPNE1
Alternative Gene Name: CPN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074643: 90%, ENSRNOG00000046990: 93%
Entrez Gene ID: 8904
Uniprot ID: Q99829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CPNE1
Alternative Gene Name: CPN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074643: 90%, ENSRNOG00000046990: 93%
Entrez Gene ID: 8904
Uniprot ID: Q99829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DLIGTFHTSLAQLQAVPAEFECIHPEKQQK |
| Documents & Links for Anti CPNE1 pAb (ATL-HPA072634 w/enhanced validation) | |
| Datasheet | Anti CPNE1 pAb (ATL-HPA072634 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CPNE1 pAb (ATL-HPA072634 w/enhanced validation) at Atlas |
| Documents & Links for Anti CPNE1 pAb (ATL-HPA072634 w/enhanced validation) | |
| Datasheet | Anti CPNE1 pAb (ATL-HPA072634 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CPNE1 pAb (ATL-HPA072634 w/enhanced validation) |