Anti COX7B pAb (ATL-HPA058041)

Atlas Antibodies

Catalog No: ATL-HPA058041-25

• 

Product Description

Protein Description: cytochrome c oxidase subunit VIIb
Gene Name: COX7B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031231: 76%, ENSRNOG00000054689: 76%
Entrez Gene ID: 1349
Uniprot ID: P24311
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDF
• Gene Sequence: MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDF
• Gene ID - Mouse: ENSMUSG00000031231
• Gene ID - Rat: ENSRNOG00000054689
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.