![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/98879/178224/atl-hpa062659_anti-cox16-pab-atl-hpa062659_59886__12265.1681133620.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp")
Protein Description: COX16 cytochrome c oxidase assembly homolog (S. cerevisiae)
Gene Name: COX16
Alternative Gene Name: C14orf112, HSPC203
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021139: 83%, ENSRNOG00000047115: 83%
Entrez Gene ID: 51241
Uniprot ID: Q9P0S2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: COX16
Alternative Gene Name: C14orf112, HSPC203
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021139: 83%, ENSRNOG00000047115: 83%
Entrez Gene ID: 51241
Uniprot ID: Q9P0S2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKT |
| Documents & Links for Anti COX16 pAb (ATL-HPA062659) | |
| Datasheet | Anti COX16 pAb (ATL-HPA062659) Datasheet (External Link) |
| Vendor Page | Anti COX16 pAb (ATL-HPA062659) at Atlas |
| Documents & Links for Anti COX16 pAb (ATL-HPA062659) | |
| Datasheet | Anti COX16 pAb (ATL-HPA062659) Datasheet (External Link) |
| Vendor Page | Anti COX16 pAb (ATL-HPA062659) |