Description
Product Description
Protein Description: coronin, actin binding protein, 1B
Gene Name: CORO1B
Alternative Gene Name: coronin-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097771: 78%, ENSRNOG00000021828: 76%
Entrez Gene ID: 57175
Uniprot ID: Q9BR76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CORO1B
Alternative Gene Name: coronin-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097771: 78%, ENSRNOG00000021828: 76%
Entrez Gene ID: 57175
Uniprot ID: Q9BR76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAAGATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGD |
Gene Sequence | AYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAAGATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGD |
Gene ID - Mouse | ENSMUSG00000097771 |
Gene ID - Rat | ENSRNOG00000021828 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CORO1B pAb (ATL-HPA070456 w/enhanced validation) | |
Datasheet | Anti CORO1B pAb (ATL-HPA070456 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CORO1B pAb (ATL-HPA070456 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CORO1B pAb (ATL-HPA070456 w/enhanced validation) | |
Datasheet | Anti CORO1B pAb (ATL-HPA070456 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CORO1B pAb (ATL-HPA070456 w/enhanced validation) |