Protein Description: corin, serine peptidase
Gene Name: CORIN
Alternative Gene Name: ATC2, CRN, Lrp4, PRSC, TMPRSS10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005220: 71%, ENSRNOG00000002302: 72%
Entrez Gene ID: 10699
Uniprot ID: Q9Y5Q5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CORIN
Alternative Gene Name: ATC2, CRN, Lrp4, PRSC, TMPRSS10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005220: 71%, ENSRNOG00000002302: 72%
Entrez Gene ID: 10699
Uniprot ID: Q9Y5Q5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NVNSSSFLMVHRAATEHHVCADGWQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQ |
| Documents & Links for Anti CORIN pAb (ATL-HPA070941) | |
| Datasheet | Anti CORIN pAb (ATL-HPA070941) Datasheet (External Link) |
| Vendor Page | Anti CORIN pAb (ATL-HPA070941) at Atlas |
| Documents & Links for Anti CORIN pAb (ATL-HPA070941) | |
| Datasheet | Anti CORIN pAb (ATL-HPA070941) Datasheet (External Link) |
| Vendor Page | Anti CORIN pAb (ATL-HPA070941) |