Description
Product Description
Protein Description: coenzyme Q8A
Gene Name: COQ8A
Alternative Gene Name: ADCK3, CABC1, COQ8, SCAR9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026489: 74%, ENSRNOG00000043201: 76%
Entrez Gene ID: 56997
Uniprot ID: Q8NI60
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: COQ8A
Alternative Gene Name: ADCK3, CABC1, COQ8, SCAR9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026489: 74%, ENSRNOG00000043201: 76%
Entrez Gene ID: 56997
Uniprot ID: Q8NI60
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAG |
Gene Sequence | LGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAG |
Gene ID - Mouse | ENSMUSG00000026489 |
Gene ID - Rat | ENSRNOG00000043201 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti COQ8A pAb (ATL-HPA061662) | |
Datasheet | Anti COQ8A pAb (ATL-HPA061662) Datasheet (External Link) |
Vendor Page | Anti COQ8A pAb (ATL-HPA061662) at Atlas Antibodies |
Documents & Links for Anti COQ8A pAb (ATL-HPA061662) | |
Datasheet | Anti COQ8A pAb (ATL-HPA061662) Datasheet (External Link) |
Vendor Page | Anti COQ8A pAb (ATL-HPA061662) |