Description
Product Description
Protein Description: coenzyme Q7 homolog, ubiquinone (yeast)
Gene Name: COQ7
Alternative Gene Name: CAT5, CLK-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030652: 92%, ENSRNOG00000017012: 92%
Entrez Gene ID: 10229
Uniprot ID: Q99807
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: COQ7
Alternative Gene Name: CAT5, CLK-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030652: 92%, ENSRNOG00000017012: 92%
Entrez Gene ID: 10229
Uniprot ID: Q99807
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFR |
Gene Sequence | TALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFR |
Gene ID - Mouse | ENSMUSG00000030652 |
Gene ID - Rat | ENSRNOG00000017012 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti COQ7 pAb (ATL-HPA071922) | |
Datasheet | Anti COQ7 pAb (ATL-HPA071922) Datasheet (External Link) |
Vendor Page | Anti COQ7 pAb (ATL-HPA071922) at Atlas Antibodies |
Documents & Links for Anti COQ7 pAb (ATL-HPA071922) | |
Datasheet | Anti COQ7 pAb (ATL-HPA071922) Datasheet (External Link) |
Vendor Page | Anti COQ7 pAb (ATL-HPA071922) |