Protein Description: coenzyme Q10A
Gene Name: COQ10A
Alternative Gene Name: FLJ32452
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039914: 97%, ENSRNOG00000029571: 97%
Entrez Gene ID: 93058
Uniprot ID: Q96MF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: COQ10A
Alternative Gene Name: FLJ32452
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039914: 97%, ENSRNOG00000029571: 97%
Entrez Gene ID: 93058
Uniprot ID: Q96MF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEV |
| Documents & Links for Anti COQ10A pAb (ATL-HPA068931) | |
| Datasheet | Anti COQ10A pAb (ATL-HPA068931) Datasheet (External Link) |
| Vendor Page | Anti COQ10A pAb (ATL-HPA068931) at Atlas |
| Documents & Links for Anti COQ10A pAb (ATL-HPA068931) | |
| Datasheet | Anti COQ10A pAb (ATL-HPA068931) Datasheet (External Link) |
| Vendor Page | Anti COQ10A pAb (ATL-HPA068931) |