Description
Product Description
Protein Description: coenzyme Q10A
Gene Name: COQ10A
Alternative Gene Name: FLJ32452
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039914: 97%, ENSRNOG00000029571: 97%
Entrez Gene ID: 93058
Uniprot ID: Q96MF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: COQ10A
Alternative Gene Name: FLJ32452
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039914: 97%, ENSRNOG00000029571: 97%
Entrez Gene ID: 93058
Uniprot ID: Q96MF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEV |
Gene Sequence | YEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEV |
Gene ID - Mouse | ENSMUSG00000039914 |
Gene ID - Rat | ENSRNOG00000029571 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti COQ10A pAb (ATL-HPA068931) | |
Datasheet | Anti COQ10A pAb (ATL-HPA068931) Datasheet (External Link) |
Vendor Page | Anti COQ10A pAb (ATL-HPA068931) at Atlas Antibodies |
Documents & Links for Anti COQ10A pAb (ATL-HPA068931) | |
Datasheet | Anti COQ10A pAb (ATL-HPA068931) Datasheet (External Link) |
Vendor Page | Anti COQ10A pAb (ATL-HPA068931) |