Protein Description: collectin sub-family member 12
Gene Name: COLEC12
Alternative Gene Name: CL-P1, SCARA4, SRCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036103: 93%, ENSRNOG00000016366: 92%
Entrez Gene ID: 81035
Uniprot ID: Q5KU26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: COLEC12
Alternative Gene Name: CL-P1, SCARA4, SRCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036103: 93%, ENSRNOG00000016366: 92%
Entrez Gene ID: 81035
Uniprot ID: Q5KU26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GYKVVEKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQ |
Documents & Links for Anti COLEC12 pAb (ATL-HPA071056) | |
Datasheet | Anti COLEC12 pAb (ATL-HPA071056) Datasheet (External Link) |
Vendor Page | Anti COLEC12 pAb (ATL-HPA071056) at Atlas |
Documents & Links for Anti COLEC12 pAb (ATL-HPA071056) | |
Datasheet | Anti COLEC12 pAb (ATL-HPA071056) Datasheet (External Link) |
Vendor Page | Anti COLEC12 pAb (ATL-HPA071056) |