Protein Description: collagen type IX alpha 2 chain
Gene Name: COL9A2
Alternative Gene Name: EDM2, MED
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028626: 83%, ENSRNOG00000011502: 83%
Entrez Gene ID: 1298
Uniprot ID: Q14055
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: COL9A2
Alternative Gene Name: EDM2, MED
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028626: 83%, ENSRNOG00000011502: 83%
Entrez Gene ID: 1298
Uniprot ID: Q14055
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RGVPGQPGRQGVEGRDATDQHIVDVALKML |
| Documents & Links for Anti COL9A2 pAb (ATL-HPA075286) | |
| Datasheet | Anti COL9A2 pAb (ATL-HPA075286) Datasheet (External Link) |
| Vendor Page | Anti COL9A2 pAb (ATL-HPA075286) at Atlas |
| Documents & Links for Anti COL9A2 pAb (ATL-HPA075286) | |
| Datasheet | Anti COL9A2 pAb (ATL-HPA075286) Datasheet (External Link) |
| Vendor Page | Anti COL9A2 pAb (ATL-HPA075286) |