Protein Description: collagen type IX alpha 1 chain
Gene Name: COL9A1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026147: 93%, ENSRNOG00000012920: 92%
Entrez Gene ID: 1297
Uniprot ID: P20849
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: COL9A1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026147: 93%, ENSRNOG00000012920: 92%
Entrez Gene ID: 1297
Uniprot ID: P20849
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLIHCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPP |
Gene ID - Mouse | ENSMUSG00000026147 |
Gene ID - Rat | ENSMUSG00000026147 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti COL9A1 pAb (ATL-HPA074749) | |
Datasheet | Anti COL9A1 pAb (ATL-HPA074749) Datasheet (External Link) |
Vendor Page | Anti COL9A1 pAb (ATL-HPA074749) at Atlas |
Documents & Links for Anti COL9A1 pAb (ATL-HPA074749) | |
Datasheet | Anti COL9A1 pAb (ATL-HPA074749) Datasheet (External Link) |
Vendor Page | Anti COL9A1 pAb (ATL-HPA074749) |