Anti COL9A1 pAb (ATL-HPA074749)

Catalog No:
ATL-HPA074749-25
$303.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: collagen type IX alpha 1 chain
Gene Name: COL9A1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026147: 93%, ENSRNOG00000012920: 92%
Entrez Gene ID: 1297
Uniprot ID: P20849
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLIHCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPP
Gene Sequence PIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLIHCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPP
Gene ID - Mouse ENSMUSG00000026147
Gene ID - Rat ENSRNOG00000012920
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COL9A1 pAb (ATL-HPA074749)
Datasheet Anti COL9A1 pAb (ATL-HPA074749) Datasheet (External Link)
Vendor Page Anti COL9A1 pAb (ATL-HPA074749) at Atlas Antibodies

Documents & Links for Anti COL9A1 pAb (ATL-HPA074749)
Datasheet Anti COL9A1 pAb (ATL-HPA074749) Datasheet (External Link)
Vendor Page Anti COL9A1 pAb (ATL-HPA074749)