Anti COL4A6 pAb (ATL-HPA065393)

Atlas Antibodies

Catalog No: ATL-HPA065393-25

• 

Product Description

Protein Description: collagen, type IV, alpha 6
Gene Name: COL4A6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031273: 53%, ENSRNOG00000056772: 53%
Entrez Gene ID: 1288
Uniprot ID: Q14031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGV
• Gene Sequence: EPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGV
• Gene ID - Mouse: ENSMUSG00000031273
• Gene ID - Rat: ENSRNOG00000056772
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.