Protein Description: collagen, type IV, alpha 6
Gene Name: COL4A6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031273: 53%, ENSRNOG00000056772: 53%
Entrez Gene ID: 1288
Uniprot ID: Q14031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: COL4A6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031273: 53%, ENSRNOG00000056772: 53%
Entrez Gene ID: 1288
Uniprot ID: Q14031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGV |
| Documents & Links for Anti COL4A6 pAb (ATL-HPA065393) | |
| Datasheet | Anti COL4A6 pAb (ATL-HPA065393) Datasheet (External Link) |
| Vendor Page | Anti COL4A6 pAb (ATL-HPA065393) at Atlas |
| Documents & Links for Anti COL4A6 pAb (ATL-HPA065393) | |
| Datasheet | Anti COL4A6 pAb (ATL-HPA065393) Datasheet (External Link) |
| Vendor Page | Anti COL4A6 pAb (ATL-HPA065393) |