![Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to endoplasmic reticulum.](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/1280x1280/products/104430/184719/atl-hpa068464_anti-col1a2-atl-hpa068464_68179__77849.1710523086.jpg?c=2 "Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to endoplasmic reticulum.")
![Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to endoplasmic reticulum.](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/104430/184719/atl-hpa068464_anti-col1a2-atl-hpa068464_68179__77849.1710523086.jpg?c=2 "Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to endoplasmic reticulum.")
Polyclonal Antibody against Human COL1A2, Gene description: collagen type I alpha 2 chain, Alternative Gene Names: OI4, Validated applications: ICC, Uniprot ID: P08123, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYAS |
| Documents & Links for Anti-COL1A2 pAb (ATL-HPA068464) | |
| Vendor Page | Anti-COL1A2 pAb (ATL-HPA068464) at Atlas |
| Documents & Links for Anti-COL1A2 pAb (ATL-HPA068464) | |
| Vendor Page | Anti-COL1A2 pAb (ATL-HPA068464) |