Description
Product Description
Protein Description: collagen, type I, alpha 2
Gene Name: COL1A2
Alternative Gene Name: OI4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029661: 83%, ENSRNOG00000011292: 81%
Entrez Gene ID: 1278
Uniprot ID: P08123
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: COL1A2
Alternative Gene Name: OI4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029661: 83%, ENSRNOG00000011292: 81%
Entrez Gene ID: 1278
Uniprot ID: P08123
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYAS |
Gene Sequence | IKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYAS |
Gene ID - Mouse | ENSMUSG00000029661 |
Gene ID - Rat | ENSRNOG00000011292 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti COL1A2 pAb (ATL-HPA059738) | |
Datasheet | Anti COL1A2 pAb (ATL-HPA059738) Datasheet (External Link) |
Vendor Page | Anti COL1A2 pAb (ATL-HPA059738) at Atlas Antibodies |
Documents & Links for Anti COL1A2 pAb (ATL-HPA059738) | |
Datasheet | Anti COL1A2 pAb (ATL-HPA059738) Datasheet (External Link) |
Vendor Page | Anti COL1A2 pAb (ATL-HPA059738) |