Protein Description: component of oligomeric golgi complex 7
Gene Name: COG7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034951: 88%, ENSRNOG00000060008: 88%
Entrez Gene ID: 91949
Uniprot ID: P83436
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: COG7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034951: 88%, ENSRNOG00000060008: 88%
Entrez Gene ID: 91949
Uniprot ID: P83436
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LPELDNMADNWLGSIARATMQTYCDAILQIPELSPHSAKQLATDIDYLINVMDALGLQPSRTLQHIVTLLKTRPEDYRQVSKGLPRRLATTVATMRSVN |
| Documents & Links for Anti COG7 pAb (ATL-HPA064645) | |
| Datasheet | Anti COG7 pAb (ATL-HPA064645) Datasheet (External Link) |
| Vendor Page | Anti COG7 pAb (ATL-HPA064645) at Atlas |
| Documents & Links for Anti COG7 pAb (ATL-HPA064645) | |
| Datasheet | Anti COG7 pAb (ATL-HPA064645) Datasheet (External Link) |
| Vendor Page | Anti COG7 pAb (ATL-HPA064645) |