Protein Description: component of oligomeric golgi complex 2
Gene Name: COG2
Alternative Gene Name: LDLC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031979: 75%, ENSRNOG00000018228: 74%
Entrez Gene ID: 22796
Uniprot ID: Q14746
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: COG2
Alternative Gene Name: LDLC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031979: 75%, ENSRNOG00000018228: 74%
Entrez Gene ID: 22796
Uniprot ID: Q14746
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VPTTASSYVDSALKPLFQLQSGHKDKLKQAIIQQWLEGTLSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDD |
| Documents & Links for Anti COG2 pAb (ATL-HPA076994) | |
| Datasheet | Anti COG2 pAb (ATL-HPA076994) Datasheet (External Link) |
| Vendor Page | Anti COG2 pAb (ATL-HPA076994) at Atlas |
| Documents & Links for Anti COG2 pAb (ATL-HPA076994) | |
| Datasheet | Anti COG2 pAb (ATL-HPA076994) Datasheet (External Link) |
| Vendor Page | Anti COG2 pAb (ATL-HPA076994) |