Anti COA6 pAb (ATL-HPA028588)

Atlas

Catalog No: ATL-HPA028588-100

• 
• 
• 

Protein Description: cytochrome c oxidase assembly factor 6 homolog (S. cerevisiae)
Gene Name: COA6
Alternative Gene Name: C1orf31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051671: 80%, ENSRNOG00000052701: 76%
Entrez Gene ID: 388753
Uniprot ID: Q5JTJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTA
• Gene Sequence: PSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTA
• Gene ID - Mouse: ENSMUSG00000051671
• Gene ID - Rat: ENSRNOG00000052701
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti COA6 pAb (ATL-HPA028588) – 1 Found

Nývltová, Eva; Dietz, Jonathan V; Seravalli, Javier; Khalimonchuk, Oleh; Barrientos, Antoni. Coordination of metal center biogenesis in human cytochrome c oxidase. Nature Communications. 2022;13(1):3615.