Description
Product Description
Protein Description: cytochrome c oxidase assembly factor 5
Gene Name: COA5
Alternative Gene Name: C2orf64, FLJ27524, MGC52110, Pet191
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026112: 81%, ENSRNOG00000018102: 81%
Entrez Gene ID: 493753
Uniprot ID: Q86WW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: COA5
Alternative Gene Name: C2orf64, FLJ27524, MGC52110, Pet191
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026112: 81%, ENSRNOG00000018102: 81%
Entrez Gene ID: 493753
Uniprot ID: Q86WW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFR |
Gene Sequence | PKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFR |
Gene ID - Mouse | ENSMUSG00000026112 |
Gene ID - Rat | ENSRNOG00000018102 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti COA5 pAb (ATL-HPA057768) | |
Datasheet | Anti COA5 pAb (ATL-HPA057768) Datasheet (External Link) |
Vendor Page | Anti COA5 pAb (ATL-HPA057768) at Atlas Antibodies |
Documents & Links for Anti COA5 pAb (ATL-HPA057768) | |
Datasheet | Anti COA5 pAb (ATL-HPA057768) Datasheet (External Link) |
Vendor Page | Anti COA5 pAb (ATL-HPA057768) |
Citations
Citations for Anti COA5 pAb (ATL-HPA057768) – 1 Found |
Nývltová, Eva; Dietz, Jonathan V; Seravalli, Javier; Khalimonchuk, Oleh; Barrientos, Antoni. Coordination of metal center biogenesis in human cytochrome c oxidase. Nature Communications. 2022;13(1):3615. PubMed |