Anti COA5 pAb (ATL-HPA057768)

Atlas Antibodies

Catalog No: ATL-HPA057768-25

• 
• 
• 

Protein Description: cytochrome c oxidase assembly factor 5
Gene Name: COA5
Alternative Gene Name: C2orf64, FLJ27524, MGC52110, Pet191
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026112: 81%, ENSRNOG00000018102: 81%
Entrez Gene ID: 493753
Uniprot ID: Q86WW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Gene Sequence: PKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFR
• Gene ID - Mouse: ENSMUSG00000026112
• Gene ID - Rat: ENSMUSG00000026112
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti COA5 pAb (ATL-HPA057768) – 1 Found

Nývltová, Eva; Dietz, Jonathan V; Seravalli, Javier; Khalimonchuk, Oleh; Barrientos, Antoni. Coordination of metal center biogenesis in human cytochrome c oxidase. Nature Communications. 2022;13(1):3615.