Protein Description: contactin associated protein-like 5
Gene Name: CNTNAP5
Alternative Gene Name: caspr5, FLJ31966
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070695: 86%, ENSRNOG00000043185: 86%
Entrez Gene ID: 129684
Uniprot ID: Q8WYK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CNTNAP5
Alternative Gene Name: caspr5, FLJ31966
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070695: 86%, ENSRNOG00000043185: 86%
Entrez Gene ID: 129684
Uniprot ID: Q8WYK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | HSVSINARRNRITLTLDDEAAPPAPDSTWVQIYSGNSYYFGGCPDNLTDSQCLNPIKAFQGCM |
Documents & Links for Anti CNTNAP5 pAb (ATL-HPA069356) | |
Datasheet | Anti CNTNAP5 pAb (ATL-HPA069356) Datasheet (External Link) |
Vendor Page | Anti CNTNAP5 pAb (ATL-HPA069356) at Atlas |
Documents & Links for Anti CNTNAP5 pAb (ATL-HPA069356) | |
Datasheet | Anti CNTNAP5 pAb (ATL-HPA069356) Datasheet (External Link) |
Vendor Page | Anti CNTNAP5 pAb (ATL-HPA069356) |