Protein Description: contactin 5
Gene Name: CNTN5
Alternative Gene Name: hNB-2, NB-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039488: 81%, ENSRNOG00000007038: 84%
Entrez Gene ID: 53942
Uniprot ID: O94779
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CNTN5
Alternative Gene Name: hNB-2, NB-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039488: 81%, ENSRNOG00000007038: 84%
Entrez Gene ID: 53942
Uniprot ID: O94779
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KSLPGLSTSYAALLRIKKSSSSSLFGSKTRPRYSSPSLGTLSASSPSWLGAAQNYYSPINLYHSSDAFKQDESVDYGPVFVQEPDDII |
Gene Sequence | KSLPGLSTSYAALLRIKKSSSSSLFGSKTRPRYSSPSLGTLSASSPSWLGAAQNYYSPINLYHSSDAFKQDESVDYGPVFVQEPDDII |
Gene ID - Mouse | ENSMUSG00000039488 |
Gene ID - Rat | ENSRNOG00000007038 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CNTN5 pAb (ATL-HPA039492) | |
Datasheet | Anti CNTN5 pAb (ATL-HPA039492) Datasheet (External Link) |
Vendor Page | Anti CNTN5 pAb (ATL-HPA039492) at Atlas Antibodies |
Documents & Links for Anti CNTN5 pAb (ATL-HPA039492) | |
Datasheet | Anti CNTN5 pAb (ATL-HPA039492) Datasheet (External Link) |
Vendor Page | Anti CNTN5 pAb (ATL-HPA039492) |