![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/90549/165083/atl-hpa039492_anti-cntn5-pab-atl-hpa039492_46727__14332.1681117671.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)")
Protein Description: contactin 5
Gene Name: CNTN5
Alternative Gene Name: hNB-2, NB-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039488: 81%, ENSRNOG00000007038: 84%
Entrez Gene ID: 53942
Uniprot ID: O94779
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CNTN5
Alternative Gene Name: hNB-2, NB-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039488: 81%, ENSRNOG00000007038: 84%
Entrez Gene ID: 53942
Uniprot ID: O94779
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KSLPGLSTSYAALLRIKKSSSSSLFGSKTRPRYSSPSLGTLSASSPSWLGAAQNYYSPINLYHSSDAFKQDESVDYGPVFVQEPDDII |
| Documents & Links for Anti CNTN5 pAb (ATL-HPA039492) | |
| Datasheet | Anti CNTN5 pAb (ATL-HPA039492) Datasheet (External Link) |
| Vendor Page | Anti CNTN5 pAb (ATL-HPA039492) at Atlas |
| Documents & Links for Anti CNTN5 pAb (ATL-HPA039492) | |
| Datasheet | Anti CNTN5 pAb (ATL-HPA039492) Datasheet (External Link) |
| Vendor Page | Anti CNTN5 pAb (ATL-HPA039492) |