Protein Description: cannabinoid receptor 1
Gene Name: CNR1
Alternative Gene Name: CANN6, CB-R, CB1, CB1A, CB1K5, CNR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044288: 100%, ENSRNOG00000008223: 100%
Entrez Gene ID: 1268
Uniprot ID: P21554
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CNR1
Alternative Gene Name: CANN6, CB-R, CB1, CB1A, CB1K5, CNR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044288: 100%, ENSRNOG00000008223: 100%
Entrez Gene ID: 1268
Uniprot ID: P21554
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKT |
| Documents & Links for Anti CNR1 pAb (ATL-HPA069945) | |
| Datasheet | Anti CNR1 pAb (ATL-HPA069945) Datasheet (External Link) |
| Vendor Page | Anti CNR1 pAb (ATL-HPA069945) at Atlas |
| Documents & Links for Anti CNR1 pAb (ATL-HPA069945) | |
| Datasheet | Anti CNR1 pAb (ATL-HPA069945) Datasheet (External Link) |
| Vendor Page | Anti CNR1 pAb (ATL-HPA069945) |