Anti CNP pAb (ATL-HPA023338 w/enhanced validation)

Catalog No:
ATL-HPA023338-25
$395.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: 2',3'-cyclic nucleotide 3' phosphodiesterase
Gene Name: CNP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006782: 87%, ENSRNOG00000017496: 88%
Entrez Gene ID: 1267
Uniprot ID: P09543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen TLARVIVDKYRDGTKMVSADAYKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLFEMADQYQYQVVLVEPKTAWRLDCAQLKEKNQW
Gene Sequence TLARVIVDKYRDGTKMVSADAYKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLFEMADQYQYQVVLVEPKTAWRLDCAQLKEKNQW
Gene ID - Mouse ENSMUSG00000006782
Gene ID - Rat ENSRNOG00000017496
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CNP pAb (ATL-HPA023338 w/enhanced validation)
Datasheet Anti CNP pAb (ATL-HPA023338 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CNP pAb (ATL-HPA023338 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CNP pAb (ATL-HPA023338 w/enhanced validation)
Datasheet Anti CNP pAb (ATL-HPA023338 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CNP pAb (ATL-HPA023338 w/enhanced validation)