Protein Description: 2',3'-cyclic nucleotide 3' phosphodiesterase
Gene Name: CNP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006782: 90%, ENSRNOG00000017496: 90%
Entrez Gene ID: 1267
Uniprot ID: P09543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CNP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006782: 90%, ENSRNOG00000017496: 90%
Entrez Gene ID: 1267
Uniprot ID: P09543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVTYFG |
Gene ID - Mouse | ENSMUSG00000006782 |
Gene ID - Rat | ENSMUSG00000006782 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CNP pAb (ATL-HPA023266 w/enhanced validation) | |
Datasheet | Anti CNP pAb (ATL-HPA023266 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CNP pAb (ATL-HPA023266 w/enhanced validation) at Atlas |
Documents & Links for Anti CNP pAb (ATL-HPA023266 w/enhanced validation) | |
Datasheet | Anti CNP pAb (ATL-HPA023266 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CNP pAb (ATL-HPA023266 w/enhanced validation) |
Citations for Anti CNP pAb (ATL-HPA023266 w/enhanced validation) – 2 Found |
Wüthrich, Christian; Batson, Stephanie; Anderson, Matthew P; White, Lon R; Koralnik, Igor J. JC Virus Infects Neurons and Glial Cells in the Hippocampus. Journal Of Neuropathology And Experimental Neurology. 2016;75(8):712-717. PubMed |
Peluffo, Hugo; Alí-Ruiz, Daniela; Ejarque-Ortíz, Aroa; Heras-Alvarez, Victor; Comas-Casellas, Emma; Martínez-Barriocanal, Agueda; Kamaid, Andres; Alvarez-Errico, Damiana; Negro, Maria Luciana; Lago, Natalia; Schwartz, Simó Jr; Villaverde, Antonio; Sayós, Joan. Overexpression of the immunoreceptor CD300f has a neuroprotective role in a model of acute brain injury. Brain Pathology (Zurich, Switzerland). 2012;22(3):318-28. PubMed |