Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-CNP antibody. Corresponding CNP RNA-seq data are presented for the same tissues.

Anti CNP pAb (ATL-HPA023278 w/enhanced validation)

Catalog No:
ATL-HPA023278-100
$505.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: 2',3'-cyclic nucleotide 3' phosphodiesterase
Gene Name: CNP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006782: 81%, ENSRNOG00000017496: 84%
Entrez Gene ID: 1267
Uniprot ID: P09543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence GCAADVEAVQTGLDLLEILRQEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII

Documents & Links for Anti CNP pAb (ATL-HPA023278 w/enhanced validation)
Datasheet Anti CNP pAb (ATL-HPA023278 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CNP pAb (ATL-HPA023278 w/enhanced validation) at Atlas

Documents & Links for Anti CNP pAb (ATL-HPA023278 w/enhanced validation)
Datasheet Anti CNP pAb (ATL-HPA023278 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CNP pAb (ATL-HPA023278 w/enhanced validation)