Anti CNOT2 pAb (ATL-HPA067711)

Atlas Antibodies

Catalog No: ATL-HPA067711-25

• 
• 
• 

Product Description

Protein Description: CCR4-NOT transcription complex, subunit 2
Gene Name: CNOT2
Alternative Gene Name: CDC36, NOT2, NOT2H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020166: 100%, ENSRNOG00000004909: 100%
Entrez Gene ID: 4848
Uniprot ID: Q9NZN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DGSENVTGLDLSDFPALADRNRREGSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPT
• Gene Sequence: DGSENVTGLDLSDFPALADRNRREGSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPT
• Gene ID - Mouse: ENSMUSG00000020166
• Gene ID - Rat: ENSRNOG00000004909
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.