Protein Description: CCR4-NOT transcription complex, subunit 2
Gene Name: CNOT2
Alternative Gene Name: CDC36, NOT2, NOT2H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020166: 100%, ENSRNOG00000004909: 100%
Entrez Gene ID: 4848
Uniprot ID: Q9NZN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CNOT2
Alternative Gene Name: CDC36, NOT2, NOT2H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020166: 100%, ENSRNOG00000004909: 100%
Entrez Gene ID: 4848
Uniprot ID: Q9NZN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DGSENVTGLDLSDFPALADRNRREGSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPT |
| Documents & Links for Anti CNOT2 pAb (ATL-HPA067711) | |
| Datasheet | Anti CNOT2 pAb (ATL-HPA067711) Datasheet (External Link) |
| Vendor Page | Anti CNOT2 pAb (ATL-HPA067711) at Atlas |
| Documents & Links for Anti CNOT2 pAb (ATL-HPA067711) | |
| Datasheet | Anti CNOT2 pAb (ATL-HPA067711) Datasheet (External Link) |
| Vendor Page | Anti CNOT2 pAb (ATL-HPA067711) |