Protein Description: CCR4-NOT transcription complex, subunit 11
Gene Name: CNOT11
Alternative Gene Name: C2orf29, C40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003135: 98%, ENSRNOG00000023220: 98%
Entrez Gene ID: 55571
Uniprot ID: Q9UKZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CNOT11
Alternative Gene Name: C2orf29, C40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003135: 98%, ENSRNOG00000023220: 98%
Entrez Gene ID: 55571
Uniprot ID: Q9UKZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FRPEFIRPPPPLHICEDELAWLNPTEPDHAIQWDKSMCVKNSTGVEIKRIMAKAFKSPLSSPQQTQLLGELEKDPKLVYHIGLT |
| Documents & Links for Anti CNOT11 pAb (ATL-HPA069823) | |
| Datasheet | Anti CNOT11 pAb (ATL-HPA069823) Datasheet (External Link) |
| Vendor Page | Anti CNOT11 pAb (ATL-HPA069823) at Atlas |
| Documents & Links for Anti CNOT11 pAb (ATL-HPA069823) | |
| Datasheet | Anti CNOT11 pAb (ATL-HPA069823) Datasheet (External Link) |
| Vendor Page | Anti CNOT11 pAb (ATL-HPA069823) |