![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101092/181139/atl-hpa073283_anti-cndp1-pab-atl-hpa073283-wenhanced-validation_62807__17584.1681137397.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: carnosine dipeptidase 1
Gene Name: CNDP1
Alternative Gene Name: CN1, CPGL2, HsT2308, MGC10825
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056162: 78%, ENSRNOG00000027739: 82%
Entrez Gene ID: 84735
Uniprot ID: Q96KN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CNDP1
Alternative Gene Name: CN1, CPGL2, HsT2308, MGC10825
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056162: 78%, ENSRNOG00000027739: 82%
Entrez Gene ID: 84735
Uniprot ID: Q96KN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTK |
| Documents & Links for Anti CNDP1 pAb (ATL-HPA073283 w/enhanced validation) | |
| Datasheet | Anti CNDP1 pAb (ATL-HPA073283 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CNDP1 pAb (ATL-HPA073283 w/enhanced validation) at Atlas |
| Documents & Links for Anti CNDP1 pAb (ATL-HPA073283 w/enhanced validation) | |
| Datasheet | Anti CNDP1 pAb (ATL-HPA073283 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CNDP1 pAb (ATL-HPA073283 w/enhanced validation) |