Anti CNDP1 pAb (ATL-HPA073283 w/enhanced validation)

Catalog No:
ATL-HPA073283-25
$447.00

Description

Product Description

Protein Description: carnosine dipeptidase 1
Gene Name: CNDP1
Alternative Gene Name: CN1, CPGL2, HsT2308, MGC10825
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056162: 78%, ENSRNOG00000027739: 82%
Entrez Gene ID: 84735
Uniprot ID: Q96KN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTK
Gene Sequence RDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTK
Gene ID - Mouse ENSMUSG00000056162
Gene ID - Rat ENSRNOG00000027739
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CNDP1 pAb (ATL-HPA073283 w/enhanced validation)
Datasheet Anti CNDP1 pAb (ATL-HPA073283 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CNDP1 pAb (ATL-HPA073283 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CNDP1 pAb (ATL-HPA073283 w/enhanced validation)
Datasheet Anti CNDP1 pAb (ATL-HPA073283 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CNDP1 pAb (ATL-HPA073283 w/enhanced validation)

Product Description

Protein Description: carnosine dipeptidase 1
Gene Name: CNDP1
Alternative Gene Name: CN1, CPGL2, HsT2308, MGC10825
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056162: 78%, ENSRNOG00000027739: 82%
Entrez Gene ID: 84735
Uniprot ID: Q96KN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTK
Gene Sequence RDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTK
Gene ID - Mouse ENSMUSG00000056162
Gene ID - Rat ENSRNOG00000027739
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CNDP1 pAb (ATL-HPA073283 w/enhanced validation)
Datasheet Anti CNDP1 pAb (ATL-HPA073283 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CNDP1 pAb (ATL-HPA073283 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CNDP1 pAb (ATL-HPA073283 w/enhanced validation)
Datasheet Anti CNDP1 pAb (ATL-HPA073283 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CNDP1 pAb (ATL-HPA073283 w/enhanced validation)