Protein Description: cardiomyopathy associated 5
Gene Name: CMYA5
Alternative Gene Name: C5orf10, DKFZp451G223, myospryn, SPRYD2, TRIM76
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047419: 40%, ENSRNOG00000023803: 48%
Entrez Gene ID: 202333
Uniprot ID: Q8N3K9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CMYA5
Alternative Gene Name: C5orf10, DKFZp451G223, myospryn, SPRYD2, TRIM76
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047419: 40%, ENSRNOG00000023803: 48%
Entrez Gene ID: 202333
Uniprot ID: Q8N3K9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FISEVSREDYGKKEISGDSEEMNINSVVTSADGENLEIQSYSLIGEKLVMEEAKTIVPPHVTDSKRVQKPAIAPPSK |
Gene ID - Mouse | ENSMUSG00000047419 |
Gene ID - Rat | ENSMUSG00000047419 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CMYA5 pAb (ATL-HPA077831 w/enhanced validation) | |
Datasheet | Anti CMYA5 pAb (ATL-HPA077831 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CMYA5 pAb (ATL-HPA077831 w/enhanced validation) at Atlas |
Documents & Links for Anti CMYA5 pAb (ATL-HPA077831 w/enhanced validation) | |
Datasheet | Anti CMYA5 pAb (ATL-HPA077831 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CMYA5 pAb (ATL-HPA077831 w/enhanced validation) |