Protein Description: c-Maf inducing protein
Gene Name: CMIP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034390: 100%, ENSRNOG00000013178: 100%
Entrez Gene ID: 80790
Uniprot ID: Q8IY22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CMIP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034390: 100%, ENSRNOG00000013178: 100%
Entrez Gene ID: 80790
Uniprot ID: Q8IY22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RDQWFHSLQWKKKIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSINQAPLEIVSKLLSENTNLTTQEHENIIVAIAPLLENNH |
| Documents & Links for Anti CMIP pAb (ATL-HPA066710 w/enhanced validation) | |
| Datasheet | Anti CMIP pAb (ATL-HPA066710 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CMIP pAb (ATL-HPA066710 w/enhanced validation) at Atlas |
| Documents & Links for Anti CMIP pAb (ATL-HPA066710 w/enhanced validation) | |
| Datasheet | Anti CMIP pAb (ATL-HPA066710 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CMIP pAb (ATL-HPA066710 w/enhanced validation) |