Description
Product Description
Protein Description: clusterin like 1
Gene Name: CLUL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020454: 24%, ENSRNOG00000059237: 56%
Entrez Gene ID: 27098
Uniprot ID: Q15846
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CLUL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020454: 24%, ENSRNOG00000059237: 56%
Entrez Gene ID: 27098
Uniprot ID: Q15846
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HLRNDSNSGNMKPPLLVFIVCLLWLKDSHCAPTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKK |
Gene Sequence | HLRNDSNSGNMKPPLLVFIVCLLWLKDSHCAPTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKK |
Gene ID - Mouse | ENSMUSG00000020454 |
Gene ID - Rat | ENSRNOG00000059237 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CLUL1 pAb (ATL-HPA075240) | |
Datasheet | Anti CLUL1 pAb (ATL-HPA075240) Datasheet (External Link) |
Vendor Page | Anti CLUL1 pAb (ATL-HPA075240) at Atlas Antibodies |
Documents & Links for Anti CLUL1 pAb (ATL-HPA075240) | |
Datasheet | Anti CLUL1 pAb (ATL-HPA075240) Datasheet (External Link) |
Vendor Page | Anti CLUL1 pAb (ATL-HPA075240) |