Protein Description: clathrin, heavy chain-like 1
Gene Name: CLTCL1
Alternative Gene Name: CHC22, CLH22, CLTCL, CLTD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047126: 50%, ENSRNOG00000004291: 50%
Entrez Gene ID: 8218
Uniprot ID: P53675
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CLTCL1
Alternative Gene Name: CHC22, CLH22, CLTCL, CLTD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047126: 50%, ENSRNOG00000004291: 50%
Entrez Gene ID: 8218
Uniprot ID: P53675
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KSVNEALNHLLTEEEDYQDAMQHAAESRDAELAQKLLQWFLEEGKRECFA |
Documents & Links for Anti CLTCL1 pAb (ATL-HPA075795) | |
Datasheet | Anti CLTCL1 pAb (ATL-HPA075795) Datasheet (External Link) |
Vendor Page | Anti CLTCL1 pAb (ATL-HPA075795) at Atlas |
Documents & Links for Anti CLTCL1 pAb (ATL-HPA075795) | |
Datasheet | Anti CLTCL1 pAb (ATL-HPA075795) Datasheet (External Link) |
Vendor Page | Anti CLTCL1 pAb (ATL-HPA075795) |