Anti CLTCL1 pAb (ATL-HPA075795)

Catalog No:
ATL-HPA075795-25
$447.00

Description

Product Description

Protein Description: clathrin, heavy chain-like 1
Gene Name: CLTCL1
Alternative Gene Name: CHC22, CLH22, CLTCL, CLTD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047126: 50%, ENSRNOG00000004291: 50%
Entrez Gene ID: 8218
Uniprot ID: P53675
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSVNEALNHLLTEEEDYQDAMQHAAESRDAELAQKLLQWFLEEGKRECFA
Gene Sequence KSVNEALNHLLTEEEDYQDAMQHAAESRDAELAQKLLQWFLEEGKRECFA
Gene ID - Mouse ENSMUSG00000047126
Gene ID - Rat ENSRNOG00000004291
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CLTCL1 pAb (ATL-HPA075795)
Datasheet Anti CLTCL1 pAb (ATL-HPA075795) Datasheet (External Link)
Vendor Page Anti CLTCL1 pAb (ATL-HPA075795) at Atlas Antibodies

Documents & Links for Anti CLTCL1 pAb (ATL-HPA075795)
Datasheet Anti CLTCL1 pAb (ATL-HPA075795) Datasheet (External Link)
Vendor Page Anti CLTCL1 pAb (ATL-HPA075795)

Product Description

Protein Description: clathrin, heavy chain-like 1
Gene Name: CLTCL1
Alternative Gene Name: CHC22, CLH22, CLTCL, CLTD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047126: 50%, ENSRNOG00000004291: 50%
Entrez Gene ID: 8218
Uniprot ID: P53675
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSVNEALNHLLTEEEDYQDAMQHAAESRDAELAQKLLQWFLEEGKRECFA
Gene Sequence KSVNEALNHLLTEEEDYQDAMQHAAESRDAELAQKLLQWFLEEGKRECFA
Gene ID - Mouse ENSMUSG00000047126
Gene ID - Rat ENSRNOG00000004291
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CLTCL1 pAb (ATL-HPA075795)
Datasheet Anti CLTCL1 pAb (ATL-HPA075795) Datasheet (External Link)
Vendor Page Anti CLTCL1 pAb (ATL-HPA075795) at Atlas Antibodies

Documents & Links for Anti CLTCL1 pAb (ATL-HPA075795)
Datasheet Anti CLTCL1 pAb (ATL-HPA075795) Datasheet (External Link)
Vendor Page Anti CLTCL1 pAb (ATL-HPA075795)