Protein Description: calsyntenin 1
Gene Name: CLSTN1
Alternative Gene Name: CDHR12, CSTN1, KIAA0911
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039953: 88%, ENSRNOG00000016398: 91%
Entrez Gene ID: 22883
Uniprot ID: O94985
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CLSTN1
Alternative Gene Name: CDHR12, CSTN1, KIAA0911
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039953: 88%, ENSRNOG00000016398: 91%
Entrez Gene ID: 22883
Uniprot ID: O94985
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TITREVEPEGDGAEDPTVQESLVSEEIVHDLDTCEVTVEGEELNHEQESLEVDMARLQQKGIEVSSSELGMTFTGVDTMASYEEVLHLLRYRNWHARSLLDRKFKL |
| Documents & Links for Anti CLSTN1 pAb (ATL-HPA077705 w/enhanced validation) | |
| Datasheet | Anti CLSTN1 pAb (ATL-HPA077705 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CLSTN1 pAb (ATL-HPA077705 w/enhanced validation) at Atlas |
| Documents & Links for Anti CLSTN1 pAb (ATL-HPA077705 w/enhanced validation) | |
| Datasheet | Anti CLSTN1 pAb (ATL-HPA077705 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CLSTN1 pAb (ATL-HPA077705 w/enhanced validation) |