Anti CLSTN1 pAb (ATL-HPA077705 w/enhanced validation)

Catalog No:
ATL-HPA077705-25
$447.00

Description

Product Description

Protein Description: calsyntenin 1
Gene Name: CLSTN1
Alternative Gene Name: CDHR12, CSTN1, KIAA0911
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039953: 88%, ENSRNOG00000016398: 91%
Entrez Gene ID: 22883
Uniprot ID: O94985
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TITREVEPEGDGAEDPTVQESLVSEEIVHDLDTCEVTVEGEELNHEQESLEVDMARLQQKGIEVSSSELGMTFTGVDTMASYEEVLHLLRYRNWHARSLLDRKFKL
Gene Sequence TITREVEPEGDGAEDPTVQESLVSEEIVHDLDTCEVTVEGEELNHEQESLEVDMARLQQKGIEVSSSELGMTFTGVDTMASYEEVLHLLRYRNWHARSLLDRKFKL
Gene ID - Mouse ENSMUSG00000039953
Gene ID - Rat ENSRNOG00000016398
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti CLSTN1 pAb (ATL-HPA077705 w/enhanced validation)
Datasheet Anti CLSTN1 pAb (ATL-HPA077705 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CLSTN1 pAb (ATL-HPA077705 w/enhanced validation)

Product Description

Protein Description: calsyntenin 1
Gene Name: CLSTN1
Alternative Gene Name: CDHR12, CSTN1, KIAA0911
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039953: 88%, ENSRNOG00000016398: 91%
Entrez Gene ID: 22883
Uniprot ID: O94985
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TITREVEPEGDGAEDPTVQESLVSEEIVHDLDTCEVTVEGEELNHEQESLEVDMARLQQKGIEVSSSELGMTFTGVDTMASYEEVLHLLRYRNWHARSLLDRKFKL
Gene Sequence TITREVEPEGDGAEDPTVQESLVSEEIVHDLDTCEVTVEGEELNHEQESLEVDMARLQQKGIEVSSSELGMTFTGVDTMASYEEVLHLLRYRNWHARSLLDRKFKL
Gene ID - Mouse ENSMUSG00000039953
Gene ID - Rat ENSRNOG00000016398
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti CLSTN1 pAb (ATL-HPA077705 w/enhanced validation)
Datasheet Anti CLSTN1 pAb (ATL-HPA077705 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CLSTN1 pAb (ATL-HPA077705 w/enhanced validation)