Description
Product Description
Protein Description: cleft lip and palate associated transmembrane protein 1
Gene Name: CLPTM1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002981: 93%, ENSRNOG00000018255: 91%
Entrez Gene ID: 1209
Uniprot ID: O96005
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CLPTM1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002981: 93%, ENSRNOG00000018255: 91%
Entrez Gene ID: 1209
Uniprot ID: O96005
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KITKVMDVRLDREHRVAGIFPRLSFKDKSTYIESSTKVYDDMAFRY |
Gene Sequence | KITKVMDVRLDREHRVAGIFPRLSFKDKSTYIESSTKVYDDMAFRY |
Gene ID - Mouse | ENSMUSG00000002981 |
Gene ID - Rat | ENSRNOG00000018255 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CLPTM1 pAb (ATL-HPA068702) | |
Datasheet | Anti CLPTM1 pAb (ATL-HPA068702) Datasheet (External Link) |
Vendor Page | Anti CLPTM1 pAb (ATL-HPA068702) at Atlas Antibodies |
Documents & Links for Anti CLPTM1 pAb (ATL-HPA068702) | |
Datasheet | Anti CLPTM1 pAb (ATL-HPA068702) Datasheet (External Link) |
Vendor Page | Anti CLPTM1 pAb (ATL-HPA068702) |