Description
Product Description
Protein Description: ClpB caseinolytic peptidase B homolog (E. coli)
Gene Name: CLPB
Alternative Gene Name: FLJ13152, HSP78, SKD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001829: 99%, ENSRNOG00000019693: 99%
Entrez Gene ID: 81570
Uniprot ID: Q9H078
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CLPB
Alternative Gene Name: FLJ13152, HSP78, SKD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001829: 99%, ENSRNOG00000019693: 99%
Entrez Gene ID: 81570
Uniprot ID: Q9H078
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RRKENGWYDEEHPLVFLFLGSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERHEVAKFIGSPPGYVGHEEGGQLTKKLKQCPNAVVLF |
Gene Sequence | RRKENGWYDEEHPLVFLFLGSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERHEVAKFIGSPPGYVGHEEGGQLTKKLKQCPNAVVLF |
Gene ID - Mouse | ENSMUSG00000001829 |
Gene ID - Rat | ENSRNOG00000019693 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CLPB pAb (ATL-HPA064571) | |
Datasheet | Anti CLPB pAb (ATL-HPA064571) Datasheet (External Link) |
Vendor Page | Anti CLPB pAb (ATL-HPA064571) at Atlas Antibodies |
Documents & Links for Anti CLPB pAb (ATL-HPA064571) | |
Datasheet | Anti CLPB pAb (ATL-HPA064571) Datasheet (External Link) |
Vendor Page | Anti CLPB pAb (ATL-HPA064571) |