Anti CLPB pAb (ATL-HPA064571)

Catalog No:
ATL-HPA064571-25
$447.00

Description

Product Description

Protein Description: ClpB caseinolytic peptidase B homolog (E. coli)
Gene Name: CLPB
Alternative Gene Name: FLJ13152, HSP78, SKD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001829: 99%, ENSRNOG00000019693: 99%
Entrez Gene ID: 81570
Uniprot ID: Q9H078
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRKENGWYDEEHPLVFLFLGSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERHEVAKFIGSPPGYVGHEEGGQLTKKLKQCPNAVVLF
Gene Sequence RRKENGWYDEEHPLVFLFLGSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERHEVAKFIGSPPGYVGHEEGGQLTKKLKQCPNAVVLF
Gene ID - Mouse ENSMUSG00000001829
Gene ID - Rat ENSRNOG00000019693
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CLPB pAb (ATL-HPA064571)
Datasheet Anti CLPB pAb (ATL-HPA064571) Datasheet (External Link)
Vendor Page Anti CLPB pAb (ATL-HPA064571) at Atlas Antibodies

Documents & Links for Anti CLPB pAb (ATL-HPA064571)
Datasheet Anti CLPB pAb (ATL-HPA064571) Datasheet (External Link)
Vendor Page Anti CLPB pAb (ATL-HPA064571)

Product Description

Protein Description: ClpB caseinolytic peptidase B homolog (E. coli)
Gene Name: CLPB
Alternative Gene Name: FLJ13152, HSP78, SKD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001829: 99%, ENSRNOG00000019693: 99%
Entrez Gene ID: 81570
Uniprot ID: Q9H078
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRKENGWYDEEHPLVFLFLGSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERHEVAKFIGSPPGYVGHEEGGQLTKKLKQCPNAVVLF
Gene Sequence RRKENGWYDEEHPLVFLFLGSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERHEVAKFIGSPPGYVGHEEGGQLTKKLKQCPNAVVLF
Gene ID - Mouse ENSMUSG00000001829
Gene ID - Rat ENSRNOG00000019693
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CLPB pAb (ATL-HPA064571)
Datasheet Anti CLPB pAb (ATL-HPA064571) Datasheet (External Link)
Vendor Page Anti CLPB pAb (ATL-HPA064571) at Atlas Antibodies

Documents & Links for Anti CLPB pAb (ATL-HPA064571)
Datasheet Anti CLPB pAb (ATL-HPA064571) Datasheet (External Link)
Vendor Page Anti CLPB pAb (ATL-HPA064571)