Description
Product Description
Protein Description: ceroid-lipofuscinosis, neuronal 6, late infantile, variant
Gene Name: CLN6
Alternative Gene Name: FLJ20561, HsT18960, nclf
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032245: 89%, ENSRNOG00000007164: 89%
Entrez Gene ID: 54982
Uniprot ID: Q9NWW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CLN6
Alternative Gene Name: FLJ20561, HsT18960, nclf
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032245: 89%, ENSRNOG00000007164: 89%
Entrez Gene ID: 54982
Uniprot ID: Q9NWW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LVFPLEWFPLNKPSVGDYFHMAYNVITPFLLLKLIERSPRTLPRSIT |
Gene Sequence | LVFPLEWFPLNKPSVGDYFHMAYNVITPFLLLKLIERSPRTLPRSIT |
Gene ID - Mouse | ENSMUSG00000032245 |
Gene ID - Rat | ENSRNOG00000007164 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CLN6 pAb (ATL-HPA074162) | |
Datasheet | Anti CLN6 pAb (ATL-HPA074162) Datasheet (External Link) |
Vendor Page | Anti CLN6 pAb (ATL-HPA074162) at Atlas Antibodies |
Documents & Links for Anti CLN6 pAb (ATL-HPA074162) | |
Datasheet | Anti CLN6 pAb (ATL-HPA074162) Datasheet (External Link) |
Vendor Page | Anti CLN6 pAb (ATL-HPA074162) |