Anti CLN6 pAb (ATL-HPA074162)

Atlas Antibodies

Catalog No: ATL-HPA074162-25

• 

Product Description

Protein Description: ceroid-lipofuscinosis, neuronal 6, late infantile, variant
Gene Name: CLN6
Alternative Gene Name: FLJ20561, HsT18960, nclf
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032245: 89%, ENSRNOG00000007164: 89%
Entrez Gene ID: 54982
Uniprot ID: Q9NWW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVFPLEWFPLNKPSVGDYFHMAYNVITPFLLLKLIERSPRTLPRSIT
• Gene Sequence: LVFPLEWFPLNKPSVGDYFHMAYNVITPFLLLKLIERSPRTLPRSIT
• Gene ID - Mouse: ENSMUSG00000032245
• Gene ID - Rat: ENSRNOG00000007164
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.