Protein Description: ceroid-lipofuscinosis, neuronal 3
Gene Name: CLN3
Alternative Gene Name: BTS, JNCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030720: 78%, ENSRNOG00000019103: 73%
Entrez Gene ID: 1201
Uniprot ID: Q13286
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CLN3
Alternative Gene Name: BTS, JNCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030720: 78%, ENSRNOG00000019103: 73%
Entrez Gene ID: 1201
Uniprot ID: Q13286
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EEEAESAARQPLIRTEAPESKPGSSSSLSLRERWTVF |
| Documents & Links for Anti CLN3 pAb (ATL-HPA063280) | |
| Datasheet | Anti CLN3 pAb (ATL-HPA063280) Datasheet (External Link) |
| Vendor Page | Anti CLN3 pAb (ATL-HPA063280) at Atlas |
| Documents & Links for Anti CLN3 pAb (ATL-HPA063280) | |
| Datasheet | Anti CLN3 pAb (ATL-HPA063280) Datasheet (External Link) |
| Vendor Page | Anti CLN3 pAb (ATL-HPA063280) |