Anti CLDN16 pAb (ATL-HPA056020 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA056020-25

• 

Product Description

Protein Description: claudin 16
Gene Name: CLDN16
Alternative Gene Name: HOMG3, PCLN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038148: 89%, ENSRNOG00000055138: 89%
Entrez Gene ID: 10686
Uniprot ID: Q9Y5I7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETAKMYAVDTRV
• Gene Sequence: LFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETAKMYAVDTRV
• Gene ID - Mouse: ENSMUSG00000038148
• Gene ID - Rat: ENSRNOG00000055138
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.