Description
Product Description
Protein Description: claudin 16
Gene Name: CLDN16
Alternative Gene Name: HOMG3, PCLN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038148: 89%, ENSRNOG00000055138: 89%
Entrez Gene ID: 10686
Uniprot ID: Q9Y5I7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CLDN16
Alternative Gene Name: HOMG3, PCLN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038148: 89%, ENSRNOG00000055138: 89%
Entrez Gene ID: 10686
Uniprot ID: Q9Y5I7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETAKMYAVDTRV |
Gene Sequence | LFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETAKMYAVDTRV |
Gene ID - Mouse | ENSMUSG00000038148 |
Gene ID - Rat | ENSRNOG00000055138 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CLDN16 pAb (ATL-HPA056020 w/enhanced validation) | |
Datasheet | Anti CLDN16 pAb (ATL-HPA056020 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CLDN16 pAb (ATL-HPA056020 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CLDN16 pAb (ATL-HPA056020 w/enhanced validation) | |
Datasheet | Anti CLDN16 pAb (ATL-HPA056020 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CLDN16 pAb (ATL-HPA056020 w/enhanced validation) |