Anti CLCN4 pAb (ATL-HPA063637)

Catalog No:
ATL-HPA063637-25
$447.00

Description

Product Description

Protein Description: chloride channel, voltage-sensitive 4
Gene Name: CLCN4
Alternative Gene Name: ClC-4, CLC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004319: 58%, ENSRNOG00000003533: 77%
Entrez Gene ID: 1183
Uniprot ID: P51793
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVNAGAMSGSGNLMDFLDEPFPDVGTYEDFH
Gene Sequence MVNAGAMSGSGNLMDFLDEPFPDVGTYEDFH
Gene ID - Mouse ENSMUSG00000004319
Gene ID - Rat ENSRNOG00000003533
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CLCN4 pAb (ATL-HPA063637)
Datasheet Anti CLCN4 pAb (ATL-HPA063637) Datasheet (External Link)
Vendor Page Anti CLCN4 pAb (ATL-HPA063637) at Atlas Antibodies

Documents & Links for Anti CLCN4 pAb (ATL-HPA063637)
Datasheet Anti CLCN4 pAb (ATL-HPA063637) Datasheet (External Link)
Vendor Page Anti CLCN4 pAb (ATL-HPA063637)

Citations

Citations for Anti CLCN4 pAb (ATL-HPA063637) – 1 Found
Gianesello, Lisa; Ceol, Monica; Bertoldi, Loris; Terrin, Liliana; Priante, Giovanna; Murer, Luisa; Peruzzi, Licia; Giordano, Mario; Paglialonga, Fabio; Cantaluppi, Vincenzo; Musetti, Claudio; Valle, Giorgio; Del Prete, Dorella; Anglani, Franca; Network, Dent Disease Italian. Genetic Analyses in Dent Disease and Characterization of CLCN5 Mutations in Kidney Biopsies. International Journal Of Molecular Sciences. 2020;21(2)  PubMed

Product Description

Protein Description: chloride channel, voltage-sensitive 4
Gene Name: CLCN4
Alternative Gene Name: ClC-4, CLC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004319: 58%, ENSRNOG00000003533: 77%
Entrez Gene ID: 1183
Uniprot ID: P51793
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVNAGAMSGSGNLMDFLDEPFPDVGTYEDFH
Gene Sequence MVNAGAMSGSGNLMDFLDEPFPDVGTYEDFH
Gene ID - Mouse ENSMUSG00000004319
Gene ID - Rat ENSRNOG00000003533
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CLCN4 pAb (ATL-HPA063637)
Datasheet Anti CLCN4 pAb (ATL-HPA063637) Datasheet (External Link)
Vendor Page Anti CLCN4 pAb (ATL-HPA063637) at Atlas Antibodies

Documents & Links for Anti CLCN4 pAb (ATL-HPA063637)
Datasheet Anti CLCN4 pAb (ATL-HPA063637) Datasheet (External Link)
Vendor Page Anti CLCN4 pAb (ATL-HPA063637)

Citations

Citations for Anti CLCN4 pAb (ATL-HPA063637) – 1 Found
Gianesello, Lisa; Ceol, Monica; Bertoldi, Loris; Terrin, Liliana; Priante, Giovanna; Murer, Luisa; Peruzzi, Licia; Giordano, Mario; Paglialonga, Fabio; Cantaluppi, Vincenzo; Musetti, Claudio; Valle, Giorgio; Del Prete, Dorella; Anglani, Franca; Network, Dent Disease Italian. Genetic Analyses in Dent Disease and Characterization of CLCN5 Mutations in Kidney Biopsies. International Journal Of Molecular Sciences. 2020;21(2)  PubMed