Protein Description: chloride channel, voltage-sensitive 4
Gene Name: CLCN4
Alternative Gene Name: ClC-4, CLC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004319: 58%, ENSRNOG00000003533: 77%
Entrez Gene ID: 1183
Uniprot ID: P51793
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CLCN4
Alternative Gene Name: ClC-4, CLC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004319: 58%, ENSRNOG00000003533: 77%
Entrez Gene ID: 1183
Uniprot ID: P51793
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MVNAGAMSGSGNLMDFLDEPFPDVGTYEDFH |
| Documents & Links for Anti CLCN4 pAb (ATL-HPA063637) | |
| Datasheet | Anti CLCN4 pAb (ATL-HPA063637) Datasheet (External Link) |
| Vendor Page | Anti CLCN4 pAb (ATL-HPA063637) at Atlas |
| Documents & Links for Anti CLCN4 pAb (ATL-HPA063637) | |
| Datasheet | Anti CLCN4 pAb (ATL-HPA063637) Datasheet (External Link) |
| Vendor Page | Anti CLCN4 pAb (ATL-HPA063637) |
| Citations for Anti CLCN4 pAb (ATL-HPA063637) – 1 Found |
| Gianesello, Lisa; Ceol, Monica; Bertoldi, Loris; Terrin, Liliana; Priante, Giovanna; Murer, Luisa; Peruzzi, Licia; Giordano, Mario; Paglialonga, Fabio; Cantaluppi, Vincenzo; Musetti, Claudio; Valle, Giorgio; Del Prete, Dorella; Anglani, Franca; Network, Dent Disease Italian. Genetic Analyses in Dent Disease and Characterization of CLCN5 Mutations in Kidney Biopsies. International Journal Of Molecular Sciences. 2020;21(2) PubMed |