Protein Description: chloride channel accessory 4
Gene Name: CLCA4
Alternative Gene Name: CaCC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068547: 80%, ENSRNOG00000029889: 75%
Entrez Gene ID: 22802
Uniprot ID: Q14CN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CLCA4
Alternative Gene Name: CaCC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068547: 80%, ENSRNOG00000029889: 75%
Entrez Gene ID: 22802
Uniprot ID: Q14CN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NEDQPFYRAKSKKIEATRCSAGISGRNRVYKCQGGSCLSRACRIDSTTKLYGKDCQFFPDKVQT |
| Documents & Links for Anti CLCA4 pAb (ATL-HPA064770) | |
| Datasheet | Anti CLCA4 pAb (ATL-HPA064770) Datasheet (External Link) |
| Vendor Page | Anti CLCA4 pAb (ATL-HPA064770) at Atlas |
| Documents & Links for Anti CLCA4 pAb (ATL-HPA064770) | |
| Datasheet | Anti CLCA4 pAb (ATL-HPA064770) Datasheet (External Link) |
| Vendor Page | Anti CLCA4 pAb (ATL-HPA064770) |