Protein Description: cytoplasmic linker associated protein 1
Gene Name: CLASP1
Alternative Gene Name: KIAA0622, MAST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064302: 95%, ENSRNOG00000002376: 95%
Entrez Gene ID: 23332
Uniprot ID: Q7Z460
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CLASP1
Alternative Gene Name: KIAA0622, MAST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064302: 95%, ENSRNOG00000002376: 95%
Entrez Gene ID: 23332
Uniprot ID: Q7Z460
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TSPTNCSHGGLSPSRLWGWSADGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDT |
| Documents & Links for Anti CLASP1 pAb (ATL-HPA065219) | |
| Datasheet | Anti CLASP1 pAb (ATL-HPA065219) Datasheet (External Link) |
| Vendor Page | Anti CLASP1 pAb (ATL-HPA065219) at Atlas |
| Documents & Links for Anti CLASP1 pAb (ATL-HPA065219) | |
| Datasheet | Anti CLASP1 pAb (ATL-HPA065219) Datasheet (External Link) |
| Vendor Page | Anti CLASP1 pAb (ATL-HPA065219) |