Anti CLASP1 pAb (ATL-HPA065219)

Atlas Antibodies

Catalog No: ATL-HPA065219-25

• 

Product Description

Protein Description: cytoplasmic linker associated protein 1
Gene Name: CLASP1
Alternative Gene Name: KIAA0622, MAST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064302: 95%, ENSRNOG00000002376: 95%
Entrez Gene ID: 23332
Uniprot ID: Q7Z460
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TSPTNCSHGGLSPSRLWGWSADGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDT
• Gene Sequence: TSPTNCSHGGLSPSRLWGWSADGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDT
• Gene ID - Mouse: ENSMUSG00000064302
• Gene ID - Rat: ENSRNOG00000002376
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.