Anti CKAP2L pAb (ATL-HPA070737)

Atlas Antibodies

Catalog No: ATL-HPA070737-25

• 
• 

Product Description

Protein Description: cytoskeleton associated protein 2-like
Gene Name: CKAP2L
Alternative Gene Name: FLJ40629, radmis
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048327: 64%, ENSRNOG00000026143: 63%
Entrez Gene ID: 150468
Uniprot ID: Q8IYA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GITSDSLVAETSITSVEELAKKMESVKSCLSPKEREQVTATPRIAKAEQHNYPGIKLQIGPIPRINGMPEVQDMKFITPVRRSSRIERAVSRYPEMLQEHDLVVAS
• Gene Sequence: GITSDSLVAETSITSVEELAKKMESVKSCLSPKEREQVTATPRIAKAEQHNYPGIKLQIGPIPRINGMPEVQDMKFITPVRRSSRIERAVSRYPEMLQEHDLVVAS
• Gene ID - Mouse: ENSMUSG00000048327
• Gene ID - Rat: ENSRNOG00000026143
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.