Anti-CITED2 pAb (ATL-HPA067368)

Catalog No:
ATL-HPA067368-100
$596.00
Polyclonal Antibody against Human CITED2, Gene description: Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 2, Alternative Gene Names: MRG1, Validated applications: ICC, Uniprot ID: Q99967, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence AFNALMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHPAAGHQMNGTNQHFRDCNPKH
Gene ID - Mouse ENSMUSG00000039910
Gene ID - Rat ENSMUSG00000039910
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti-CITED2 pAb (ATL-HPA067368)
Vendor Page Anti-CITED2 pAb (ATL-HPA067368) at Atlas

Documents & Links for Anti-CITED2 pAb (ATL-HPA067368)
Vendor Page Anti-CITED2 pAb (ATL-HPA067368)