Polyclonal Antibody against Human CITED2, Gene description: Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 2, Alternative Gene Names: MRG1, Validated applications: ICC, Uniprot ID: Q99967, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AFNALMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHPAAGHQMNGTNQHFRDCNPKH |
Gene ID - Mouse | ENSMUSG00000039910 |
Gene ID - Rat | ENSMUSG00000039910 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti-CITED2 pAb (ATL-HPA067368) | |
Vendor Page | Anti-CITED2 pAb (ATL-HPA067368) at Atlas |
Documents & Links for Anti-CITED2 pAb (ATL-HPA067368) | |
Vendor Page | Anti-CITED2 pAb (ATL-HPA067368) |