Protein Description: cell death-inducing DFFA-like effector c
Gene Name: CIDEC
Alternative Gene Name: CIDE-3, FLJ20871, Fsp27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030278: 76%, ENSRNOG00000009153: 76%
Entrez Gene ID: 63924
Uniprot ID: Q96AQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CIDEC
Alternative Gene Name: CIDE-3, FLJ20871, Fsp27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030278: 76%, ENSRNOG00000009153: 76%
Entrez Gene ID: 63924
Uniprot ID: Q96AQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVT |
| Documents & Links for Anti CIDEC pAb (ATL-HPA020553) | |
| Datasheet | Anti CIDEC pAb (ATL-HPA020553) Datasheet (External Link) |
| Vendor Page | Anti CIDEC pAb (ATL-HPA020553) at Atlas |
| Documents & Links for Anti CIDEC pAb (ATL-HPA020553) | |
| Datasheet | Anti CIDEC pAb (ATL-HPA020553) Datasheet (External Link) |
| Vendor Page | Anti CIDEC pAb (ATL-HPA020553) |
| Citations for Anti CIDEC pAb (ATL-HPA020553) – 1 Found |
| Morén, Björn; Fryklund, Claes; Stenkula, Karin. Surface-associated lipid droplets: an intermediate site for lipid transport in human adipocytes?. Adipocyte. 2020;9(1):636-648. PubMed |