Polyclonal Antibody against Human CIB1, Gene description: calcium and integrin binding 1, Alternative Gene Names: CIB, KIP, SIP2-28, Validated applications: WB, IHC, Uniprot ID: Q99828, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC, WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSF |
| Gene ID - Mouse | ENSMUSG00000030538 |
| Gene ID - Rat | ENSMUSG00000030538 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti-CIB1 pAb (ATL-HPA074310) | |
| Vendor Page | Anti-CIB1 pAb (ATL-HPA074310) at Atlas |
| Documents & Links for Anti-CIB1 pAb (ATL-HPA074310) | |
| Vendor Page | Anti-CIB1 pAb (ATL-HPA074310) |