Protein Description: carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4
Gene Name: CHST4
Alternative Gene Name: HEC-GLCNAC-6-ST, LSST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035930: 75%, ENSRNOG00000016953: 74%
Entrez Gene ID: 10164
Uniprot ID: Q8NCG5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CHST4
Alternative Gene Name: HEC-GLCNAC-6-ST, LSST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035930: 75%, ENSRNOG00000016953: 74%
Entrez Gene ID: 10164
Uniprot ID: Q8NCG5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKACGDAMNLLGYRHVRSEQEQRNLLLDLLSTWTVPEQIH |
| Gene Sequence | TSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKACGDAMNLLGYRHVRSEQEQRNLLLDLLSTWTVPEQIH |
| Gene ID - Mouse | ENSMUSG00000035930 |
| Gene ID - Rat | ENSRNOG00000016953 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CHST4 pAb (ATL-HPA021955 w/enhanced validation) | |
| Datasheet | Anti CHST4 pAb (ATL-HPA021955 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CHST4 pAb (ATL-HPA021955 w/enhanced validation) at Atlas |
| Documents & Links for Anti CHST4 pAb (ATL-HPA021955 w/enhanced validation) | |
| Datasheet | Anti CHST4 pAb (ATL-HPA021955 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CHST4 pAb (ATL-HPA021955 w/enhanced validation) |