Description
Product Description
Protein Description: carbohydrate (chondroitin 6) sulfotransferase 3
Gene Name: CHST3
Alternative Gene Name: C6ST, C6ST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057337: 84%, ENSRNOG00000000572: 86%
Entrez Gene ID: 9469
Uniprot ID: Q7LGC8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CHST3
Alternative Gene Name: C6ST, C6ST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057337: 84%, ENSRNOG00000000572: 86%
Entrez Gene ID: 9469
Uniprot ID: Q7LGC8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRL |
Gene Sequence | IISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRL |
Gene ID - Mouse | ENSMUSG00000057337 |
Gene ID - Rat | ENSRNOG00000000572 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CHST3 pAb (ATL-HPA055704 w/enhanced validation) | |
Datasheet | Anti CHST3 pAb (ATL-HPA055704 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CHST3 pAb (ATL-HPA055704 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CHST3 pAb (ATL-HPA055704 w/enhanced validation) | |
Datasheet | Anti CHST3 pAb (ATL-HPA055704 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CHST3 pAb (ATL-HPA055704 w/enhanced validation) |